PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00278.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 318aa    MW: 35670.2 Da    PI: 5.7899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00278.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.82.1e-49181471128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkklelee...vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                              lppGfrFhP+d+elv++yL ++  g++++ +     + +vd++k+ePwd+pk++  + k+wyf+s+rd+kyatg r+nrat++gyW
  Rsa1.0_00278.1_g00019.1  18 LPPGFRFHPKDDELVCDYLMARSLGDNINQTPpplLLIQVDLNKCEPWDIPKTACVGGKDWYFYSQRDRKYATGLRTNRATATGYW 103
                              79***********************996664344358999***********8777799**************************** PP

                      NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              katgkd+++l+ k++lvg++ktLvfy+grap+g+k+dWvmhe+rl
  Rsa1.0_00278.1_g00019.1 104 KATGKDRAILR-KSKLVGMRKTLVFYQGRAPRGRKSDWVMHEFRL 147
                              **********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-589174IPR003441NAC domain
PROSITE profilePS5100554.65118173IPR003441NAC domain
PfamPF023651.8E-2519147IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MESEEKKESS ISTVEAKLPP GFRFHPKDDE LVCDYLMARS LGDNINQTPP PLLLIQVDLN  60
KCEPWDIPKT ACVGGKDWYF YSQRDRKYAT GLRTNRATAT GYWKATGKDR AILRKSKLVG  120
MRKTLVFYQG RAPRGRKSDW VMHEFRLQGS FDPPTLNSPE VQEDWVLCRV FHKNTEGVLS  180
RDNVGSCFDE TASASLPPLM DSYINFDQEP SSYLGDDQHF ITNEQVPCFS NLSKNQTLTN  240
SVSELKKNPI PLFTGGSAPT RLPGLDSFYS SDQMVLRALL SQLTKIDGGI EVKEAQSYGE  300
GSSESFLTDI GIPSTAWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-49121769171Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667490.0KC966749.1 Brassica napus NAC transcription factor 22 (NAC22.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625043.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE60.0NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A078F7U90.0A0A078F7U9_BRANA; BnaC03g70990D protein
TrEMBLA0A0D3BNE10.0A0A0D3BNE1_BRAOL; Uncharacterized protein
STRINGBra030820.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.20.0NAC domain containing protein 1